PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00571.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 213aa    MW: 23395.2 Da    PI: 6.5139
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00571.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.8e-162471148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg W++eEde+l   ++ +G  tW+++a+  g++R++k+c++rw +yl
  Zmw_sc00571.1.g00200.1.sm.mk 24 RGLWSPEEDERLFTQITCHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 71
                                  788*******************************************97 PP

2Myb_DNA-binding46.11.2e-1479120346
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   + +++E+e ++ + k lG++ W++Ia++++ gRt++ +k++w++
  Zmw_sc00571.1.g00200.1.sm.mk  79 PISEQEEETIISLQKSLGNR-WSAIAAELP-GRTDNAIKNHWNS 120
                                   679*****************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9031971IPR017930Myb domain
SuperFamilySSF466891.12E-2723118IPR009057Homeodomain-like
SMARTSM007171.8E-102373IPR001005SANT/Myb domain
PfamPF002491.9E-132471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-212578IPR009057Homeodomain-like
CDDcd001671.98E-82771No hitNo description
PROSITE profilePS5129423.63172126IPR017930Myb domain
SMARTSM007176.5E-1376124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2379126IPR009057Homeodomain-like
CDDcd001671.28E-979119No hitNo description
PfamPF002497.6E-1379120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MARKPNQHAA AGTGAAAEEK KERRGLWSPE EDERLFTQIT CHGVSTWSSV AQLAGLRRSG  60
KSCRLRWMNY LRPDLRKEPI SEQEEETIIS LQKSLGNRWS AIAAELPGRT DNAIKNHWNS  120
RIRKRLNAAA NAGQCRAGNS TAEGQAPAAG EKEEHTNNAA KAAAPSPIPV FACQLLDGGA  180
QAFHELDYVD DLLIDVPGHM DAWESELFSL DIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-272412627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.12e-86PREDICTED: transcription factor MYB82-like
SwissprotP200273e-46MYB3_HORVU; Myb-related protein Hv33
TrEMBLK3XL223e-86K3XL22_SETIT; Uncharacterized protein
STRINGSi002595m8e-86(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545